Recombinant Mouse H-2 class II histocompatibility antigen gamma chain(Cd74) ,partial

bioma

Size

1 mg

Catalog No.

RPC20020

Price

1599 EUR

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Protein sequence

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Other name

Ia antigen-associated invariant chain ; IiMHC class II-associated invariant chain; CD74

Description

Antigens are peptides or recombinant or native dependent on the production method.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Notes

For research use only. Not for diagnostic procedures.

Source

Recombinants or rec. proteins

Verified reactivity

Mus musculus (Mouse)

Information about sequence

Extracellular Domain

Estimated production time

7-11 business days

Latin name

Mus musculus

Group

recombinants

Shipping requirements

Blue ice

Protein region

56-279aa

Expected molecular weight

29.5kDa

Protein purity

≥ 90%

Protein number

P04441

Use before

1 year

Protein origin

E.coli

Gene number

Cd74