Recombinant Mouse Histone deacetylase complex subunit SAP130(Sap130),partial

bioma

Size

500 μg

Catalog No.

RPC20322

Price

1078 EUR

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Protein sequence

PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

Other name

130 kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Notes

For research use only. Not for diagnostic procedures.

Source

Recombinants or rec. proteins

Verified reactivity

Mus musculus (Mouse)

Estimated production time

7-11 business days

Latin name

Mus musculus

Group

recombinants

Protein region

845-1057aa

Shipping requirements

Blue ice

Expected molecular weight

26.78kDa

Information about sequence

Partial

Protein purity

≥ 90%

Protein number

Q8BIH0

Use before

1 year

Gene number

Sap130

Protein origin

Yeast