Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C(JMJD1C) ,partial

bioma

Size

500 μg

Catalog No.

RPC20550

Price

1078 EUR

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Protein sequence

MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR

Other name

Jumonji domain-containing protein 1C; Thyroid receptor-interacting protein 8

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Notes

For research use only. Not for diagnostic procedures.

Source

Recombinants or rec. proteins

Verified reactivity

Homo sapiens (Human)

Estimated production time

7-11 business days

Group

recombinants

Protein region

2274-2498aa

Expected molecular weight

42.97kDa

Shipping requirements

Blue ice

Information about sequence

Partial

Protein purity

≥ 90%

Protein number

Q15652

Use before

1 year

Protein origin

E.coli

Gene number

JMJD1C