Recombinant Human HLA class II histocompatibility antigen, DRB1-1 beta chain(HLA-DRB1),partial

bioma

Size

1 mg

Catalog No.

RPC20468

Price

1074 EUR

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Protein sequence

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Description

Antigens are peptides or recombinant or native dependent on the production method.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Notes

For research use only. Not for diagnostic procedures.

Source

Recombinants or rec. proteins

Other name

MHC class II antigen DRB1*1

Verified reactivity

Homo sapiens (Human)

Information about sequence

Extracellular Domain

Estimated production time

7-11 business days

Group

recombinants

Shipping requirements

Blue ice

Expected molecular weight

41.97kDa

Protein region

30-227aa

Gene number

HLA-DRB1

Protein purity

≥ 90%

Use before

1 year

Protein number

P04229

Protein origin

E.coli