Recombinant Human Histone deacetylase 6(HDAC6)

bioma

Size

1 mg

Catalog No.

RPC20451

Price

1599 EUR

Protein sequence

MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Notes

For research use only. Not for diagnostic procedures.

Source

Recombinants or rec. proteins

Verified reactivity

Homo sapiens (Human)

Other name

no alternative name

Estimated production time

7-11 business days

Group

recombinants

Shipping requirements

Blue ice

Expected molecular weight

69.68kD

Information about sequence

Partial

Protein region

1-488aa

Protein purity

≥ 90%

Protein number

Q9UBN7

Use before

1 year

Protein origin

E.coli

Gene number

HDAC6