Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLA-G)

bioma

Size

20 μg

Catalog No.

RPC20584

Price

567 EUR

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Protein sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Description

The Recombinant HLA class I histocompatibility antigen, alpha chain G protein(HLA-G) is a α- or alpha protein sometimes glycoprotein present in blood.Antigens are peptides or recombinant or native dependent on the production method.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Notes

For research use only. Not for diagnostic procedures.

Other name

HLA G antigen; MHC class I antigen G

Source

Recombinants or rec. proteins

Verified reactivity

Homo sapiens (Human)

Estimated production time

7-11 business days

Protein origin

Mammalian cell

Group

recombinants

Information about sequence

Full Length

Shipping requirements

Blue ice

Expected molecular weight

18.18kDa

Protein region

25-338aa

Protein purity

≥ 90%

Use before

1 year

Protein number

P17693

Gene number

HLA-G