Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 kDa Isozyme/GST
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Additional description
The kilo Daltons subunit weight of Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 Isozyme/GST compared to your protein ladder can be shifted a little due to electrophoresis effects. 1 kDa = 1000 g/mol protein
Peptide sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSD
Description
Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 kDa Isozyme is produced by our E.coli expression system and the target gene encoding Met1-Lys218 is expressed.
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Package form
Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Reconstitution conditions
See included datasheet or contact us for more information.
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Source
Recombinants or rec. proteins
Shipping condition
Ambient/Room Temperature
Species reactivity
Schistosoma Japonicum
Estimated molecular weight
25,7 kDa
