Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C(JMJD1C) ,partial
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Protein sequence
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Other name
Jumonji domain-containing protein 1C; Thyroid receptor-interacting protein 8
Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing.
Notes
For research use only. Not for diagnostic procedures.
Verified applications
See product datasheet or contact us
Source
Recombinants or rec. proteins
Verified reactivity
Homo sapiens (Human)
Estimated production time
7-11 business days
Protein region
2274-2498aa
Expected molecular weight
42,97kDa
Shipping requirements
Blue ice
Information about sequence
Partial
