Recombinant Mouse H-2 class II histocompatibility antigen gamma chain(Cd74) ,partial
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Protein sequence
QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
Other name
Ia antigen-associated invariant chain ; IiMHC class II-associated invariant chain; CD74
Description
Antigens are peptides or recombinant or native dependent on the production method.
Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing.
Notes
For research use only. Not for diagnostic procedures.
Verified applications
See product datasheet or contact us
Source
Recombinants or rec. proteins
Verified reactivity
Mus musculus (Mouse)
Information about sequence
Extracellular Domain
Estimated production time
7-11 business days
Shipping requirements
Blue ice
Expected molecular weight
29,5kDa
