Recombinant Mouse Histone deacetylase complex subunit SAP130(Sap130),partial
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Protein sequence
PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV
Other name
130 kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130
Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing.
Notes
For research use only. Not for diagnostic procedures.
Source
Recombinants or rec. proteins
Verified reactivity
Mus musculus (Mouse)
Estimated production time
7-11 business days
Protein region
845-1057aa
Shipping requirements
Blue ice
Expected molecular weight
26.78kDa
Information about sequence
Partial