Recombinant Human HLA class II histocompatibility antigen, DRB1-1 beta chain(HLA-DRB1),partial
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Protein sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK
Description
Antigens are peptides or recombinant or native dependent on the production method.
Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing.
Notes
For research use only. Not for diagnostic procedures.
Source
Recombinants or rec. proteins
Other name
MHC class II antigen DRB1*1
Verified reactivity
Homo sapiens (Human)
Information about sequence
Extracellular Domain
Estimated production time
7-11 business days
Shipping requirements
Blue ice
Expected molecular weight
41.97kDa
