Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLA-G)
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Protein sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Description
The Recombinant HLA class I histocompatibility antigen, alpha chain G protein(HLA-G) is a α- or alpha protein sometimes glycoprotein present in blood.Antigens are peptides or recombinant or native dependent on the production method.
Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing.
Notes
For research use only. Not for diagnostic procedures.
Other name
HLA G antigen; MHC class I antigen G
Source
Recombinants or rec. proteins
Verified reactivity
Homo sapiens (Human)
Estimated production time
7-11 business days
Protein origin
Mammalian cell
Information about sequence
Full Length
Shipping requirements
Blue ice
Expected molecular weight
18.18kDa
